PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009778344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 135aa    MW: 16066.2 Da    PI: 9.3098
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009778344.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.89.5e-131371563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++ +r+ +NRe+ArrsR RK++ +      v++L++eN + +  ++  ++++a++++e+
  XP_009778344.1 13 RKRKRMVSNRESARRSRMRKQKHLYDMMSQVEQLKEENIKIITSINLATQNYATVEAEN 71
                    57799***********************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.8E-10859No hitNo description
SMARTSM003382.8E-13973IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2771174IPR004827Basic-leucine zipper domain
PfamPF001707.4E-101371IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-111365No hitNo description
CDDcd147029.53E-181465No hitNo description
PROSITE patternPS0003601631IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MTSSSSGDLM NERKRKRMVS NRESARRSRM RKQKHLYDMM SQVEQLKEEN IKIITSINLA  60
TQNYATVEAE NTVLRVQMME LNQRLHSLND ILSYINNNGT IFEDHNYPET FVNNPWNFMY  120
QNQPIMASAH MLYHY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11233RKRKRMVSNRESARRSRMRKQK
22532RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778344.16e-97PREDICTED: ocs element-binding factor 1-like
RefseqXP_016452795.16e-97PREDICTED: bZIP transcription factor 53-like
TrEMBLM0ZWC73e-50M0ZWC7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000094939e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-42basic leucine-zipper 44